Placeholder image of a protein
Icon representing a puzzle

1943: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
January 13, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Beta Folders 100 pts. 11,895
  2. Avatar for Go Science 2. Go Science 68 pts. 11,795
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 11,780
  4. Avatar for Contenders 4. Contenders 27 pts. 11,645
  5. Avatar for Gargleblasters 5. Gargleblasters 16 pts. 11,441
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 11,342
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 11,293
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 3 pts. 10,707
  9. Avatar for Team China 9. Team China 1 pt. 10,622
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 10,470

  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 1 pt. 11,758
  2. Avatar for Galaxie 12. Galaxie Lv 1 1 pt. 11,734
  3. Avatar for phi16 13. phi16 Lv 1 1 pt. 11,723
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 1 pt. 11,682
  5. Avatar for robgee 15. robgee Lv 1 1 pt. 11,680
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 1 pt. 11,645
  7. Avatar for alcor29 17. alcor29 Lv 1 1 pt. 11,552

Comments


WBarme1234 Lv 1

Puzzle 1943 - Wrong disulfide count -
Usually two(2) disulfide bridges gives 500 points; i'm getting only 250 points -> replacing Puzzle to 1943b?