Placeholder image of a protein
Icon representing a puzzle

1943: Revisiting Puzzle 165: Rosetta Model 15

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 13, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Beta Folders 100 pts. 11,895
  2. Avatar for Go Science 2. Go Science 68 pts. 11,795
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 11,780
  4. Avatar for Contenders 4. Contenders 27 pts. 11,645
  5. Avatar for Gargleblasters 5. Gargleblasters 16 pts. 11,441
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 11,342
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 11,293
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 3 pts. 10,707
  9. Avatar for Team China 9. Team China 1 pt. 10,622
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 10,470

  1. Avatar for fpc 11. fpc Lv 1 68 pts. 11,342
  2. Avatar for pauldunn 12. pauldunn Lv 1 65 pts. 11,298
  3. Avatar for Deleted player 13. Deleted player 62 pts. 11,296
  4. Avatar for jobo0502 14. jobo0502 Lv 1 60 pts. 11,293
  5. Avatar for infjamc 15. infjamc Lv 1 57 pts. 11,273
  6. Avatar for dcrwheeler 16. dcrwheeler Lv 1 55 pts. 11,267
  7. Avatar for drjr 17. drjr Lv 1 52 pts. 11,259
  8. Avatar for robgee 18. robgee Lv 1 50 pts. 11,245
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 48 pts. 11,228
  10. Avatar for ichwilldiesennamen 20. ichwilldiesennamen Lv 1 46 pts. 11,195

Comments


WBarme1234 Lv 1

Puzzle 1943 - Wrong disulfide count -
Usually two(2) disulfide bridges gives 500 points; i'm getting only 250 points -> replacing Puzzle to 1943b?