Placeholder image of a protein
Icon representing a puzzle

1943: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 13, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,895
  2. Avatar for Go Science 2. Go Science 68 pts. 11,795
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 11,780
  4. Avatar for Contenders 4. Contenders 27 pts. 11,645
  5. Avatar for Gargleblasters 5. Gargleblasters 16 pts. 11,441
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 11,342
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 11,293
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 3 pts. 10,707
  9. Avatar for Team China 9. Team China 1 pt. 10,622
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 10,470
  1. Avatar for BootsMcGraw 31. BootsMcGraw Lv 1 27 pts. 11,064
  2. Avatar for Vinara 32. Vinara Lv 1 26 pts. 11,044
  3. Avatar for akaaka 33. akaaka Lv 1 25 pts. 11,030
  4. Avatar for GuR0 34. GuR0 Lv 1 24 pts. 11,015
  5. Avatar for borattt 35. borattt Lv 1 22 pts. 11,013
  6. Avatar for silent gene 36. silent gene Lv 1 21 pts. 11,003
  7. Avatar for Lotus23 37. Lotus23 Lv 1 20 pts. 10,977
  8. Avatar for fiendish_ghoul 38. fiendish_ghoul Lv 1 19 pts. 10,975
  9. Avatar for OWM3 39. OWM3 Lv 1 18 pts. 10,965
  10. Avatar for Skippysk8s 40. Skippysk8s Lv 1 17 pts. 10,964

Comments

WBarme1234 Lv 1

Puzzle 1943 - Wrong disulfide count -
Usually two(2) disulfide bridges gives 500 points; i'm getting only 250 points -> replacing Puzzle to 1943b?