Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 2 pts. 10,533
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,269
  3. Avatar for Australia 13. Australia 1 pt. 10,133
  4. Avatar for Korean 14. Korean 1 pt. 9,785
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,130
  6. Avatar for Deleted group 16. Deleted group pts. 8,801
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 0
  8. Avatar for Window Group 18. Window Group 1 pt. 0
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,576
  2. Avatar for grogar7 2. grogar7 Lv 1 97 pts. 11,561
  3. Avatar for Enzyme 3. Enzyme Lv 1 94 pts. 11,440
  4. Avatar for Aubade01 4. Aubade01 Lv 1 90 pts. 11,426
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 87 pts. 11,420
  6. Avatar for mirp 6. mirp Lv 1 84 pts. 11,398
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 81 pts. 11,375
  8. Avatar for christioanchauvin 8. christioanchauvin Lv 1 78 pts. 11,341
  9. Avatar for fiendish_ghoul 9. fiendish_ghoul Lv 1 75 pts. 11,316
  10. Avatar for ichwilldiesennamen 10. ichwilldiesennamen Lv 1 72 pts. 11,275

Comments