Placeholder image of a protein
Icon representing a puzzle

1946: Revisiting Puzzle 52: Bacteria Energy

Closed since about 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
January 20, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for Beta Folders 100 pts. 11,576
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 11,561
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 11,440
  4. Avatar for Go Science 4. Go Science 38 pts. 11,436
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,341
  6. Avatar for Contenders 6. Contenders 18 pts. 11,188
  7. Avatar for Marvin's bunch 7. Marvin's bunch 12 pts. 10,933
  8. Avatar for Olsztynek 8. Olsztynek 8 pts. 10,872
  9. Avatar for Team China 9. Team China 5 pts. 10,629
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 10,600

  1. Avatar for Danilino98 131. Danilino98 Lv 1 1 pt. 8,782
  2. Avatar for Waukeeblobel 132. Waukeeblobel Lv 1 1 pt. 1,285
  3. Avatar for nahunhee 133. nahunhee Lv 1 1 pt. 0
  4. Avatar for RockOn 134. RockOn Lv 1 1 pt. 0
  5. Avatar for jgreene305 135. jgreene305 Lv 1 1 pt. 0
  6. Avatar for osnazgry 136. osnazgry Lv 1 1 pt. 0
  7. Avatar for toshiue 137. toshiue Lv 1 1 pt. 0
  8. Avatar for devjosh 139. devjosh Lv 1 1 pt. 0
  9. Avatar for jflat06 140. jflat06 Lv 1 1 pt. 0

Comments