Placeholder image of a protein
Icon representing a puzzle

1955: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
February 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Olsztynek 11. Olsztynek 1 pt. 9,025
  2. Avatar for Australia 12. Australia 1 pt. 9,007
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,972
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,913
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,697
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 7,366
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 5,479
  1. Avatar for ZeroLeak7
    1. ZeroLeak7 Lv 1
    100 pts. 10,626
  2. Avatar for fiendish_ghoul 2. fiendish_ghoul Lv 1 97 pts. 10,578
  3. Avatar for LociOiling 3. LociOiling Lv 1 94 pts. 10,568
  4. Avatar for Fetztastic 4. Fetztastic Lv 1 91 pts. 10,559
  5. Avatar for Skippysk8s 5. Skippysk8s Lv 1 88 pts. 10,556
  6. Avatar for ucad 6. ucad Lv 1 85 pts. 10,544
  7. Avatar for mirp 7. mirp Lv 1 82 pts. 10,532
  8. Avatar for christioanchauvin 8. christioanchauvin Lv 1 79 pts. 10,527
  9. Avatar for frood66 9. frood66 Lv 1 76 pts. 10,521
  10. Avatar for grogar7 10. grogar7 Lv 1 73 pts. 10,498

Comments