Placeholder image of a protein
Icon representing a puzzle

1955: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Go Science 100 pts. 10,673
  2. Avatar for Marvin's bunch 2. Marvin's bunch 73 pts. 10,598
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,568
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 10,556
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,527
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 16 pts. 10,498
  7. Avatar for Contenders 7. Contenders 10 pts. 10,391
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,644
  9. Avatar for Team China 9. Team China 4 pts. 9,630
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,269

  1. Avatar for Dhalion 111. Dhalion Lv 1 1 pt. 8,215
  2. Avatar for borattt 112. borattt Lv 1 1 pt. 8,198
  3. Avatar for CAN1958 113. CAN1958 Lv 1 1 pt. 8,123
  4. Avatar for ProfVince 114. ProfVince Lv 1 1 pt. 8,088
  5. Avatar for phi16 115. phi16 Lv 1 1 pt. 8,000
  6. Avatar for Agustinesp3 116. Agustinesp3 Lv 1 1 pt. 7,848
  7. Avatar for alwen 117. alwen Lv 1 1 pt. 7,712
  8. Avatar for mollyfoldit 118. mollyfoldit Lv 1 1 pt. 7,703
  9. Avatar for Yann1ck2000 119. Yann1ck2000 Lv 1 1 pt. 7,655
  10. Avatar for Kajmarez 120. Kajmarez Lv 1 1 pt. 7,628

Comments