Placeholder image of a protein
Icon representing a puzzle

1955: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
February 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,673
  2. Avatar for Marvin's bunch 2. Marvin's bunch 73 pts. 10,598
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,568
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 10,556
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,527
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 16 pts. 10,498
  7. Avatar for Contenders 7. Contenders 10 pts. 10,391
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 9,644
  9. Avatar for Team China 9. Team China 4 pts. 9,630
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,269
  1. Avatar for heather-1 51. heather-1 Lv 1 13 pts. 9,775
  2. Avatar for blazegeek 52. blazegeek Lv 1 12 pts. 9,760
  3. Avatar for alcor29 53. alcor29 Lv 1 12 pts. 9,758
  4. Avatar for fpc 54. fpc Lv 1 11 pts. 9,700
  5. Avatar for antibot215 55. antibot215 Lv 1 11 pts. 9,662
  6. Avatar for Deleted player 56. Deleted player pts. 9,655
  7. Avatar for Simek 57. Simek Lv 1 10 pts. 9,644
  8. Avatar for REDing 58. REDing Lv 1 9 pts. 9,630
  9. Avatar for abiogenesis 59. abiogenesis Lv 1 9 pts. 9,621
  10. Avatar for NeedMoreCoffee 60. NeedMoreCoffee Lv 1 8 pts. 9,593

Comments