1961: Revisiting Puzzle 57: Beta-Neurotoxin
Closed since over 5 years ago
Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction PredictionSummary
- Created
- February 25, 2021
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC
Top groups
-
1. Aubade01 Lv 1100 pts. 10,567 -
-
-
-
-
-
-
-
-
Comments
APPAAP Lv 1
Does anyone has notice stability problems with this version? I had several breakdowns and needed to restart it many times. I use Windows 7 Home premium 64-bit. Also in the Rama map when I select a residue it is not noticed-marked, although in the protein the residue has a noticed change.
APPAAP Lv 1
I downloaded and installed Foldit 20210222-46aaceaf66-win_x86
but problem persists. When I login and open the puzzle my score says 9415 and Objective bonus +500 but a little bit later windows reports Foldit.exe has stopped working Close program. I didn't save this one pose in the past.
LociOiling Lv 1
The first selected segment isn't highlighted on the Rama map, which is confusing. The devs are aware of the issue and are working on a fix.
In the selection interface, a workaround for seeing a specific segment is to first select any other segment, then select the segment you want. The segment you want will be highlighted with a white box on the Rama map. If you de-select the first segment, your segment loses the highlight. So you have to remember its position if you want to move by itself.
milkshake Lv 1
Thanks APPAAP and Loci. Yes, as Loci says, we are working on publishing a fix to this ASAP.
milkshake Lv 1
Hi APPAAP, is there enough time to click the "share with scientists" button? I would like to investigate your crash but I am not experiencing any crashes on puzzle 1961. Thank you.
APPAAP Lv 1
Where is the "share with scientist" button? When logged in I cannot get to the puzzle as soloist.
Can do that from the foldit portal site?
I will try to attach a png image of my laptop screen. Foldit works fine when I am not logged in, as an evolver but when I logged in it tries to get the last saved best score which seems to be problematic. May need to erase some file?
APPAAP Lv 1
I disabled all autosave and last quicksave file solutions from foldit default folder (soloist). Then logged in without a problem as a soloist at initial possition (start). Last loaded a saved evolver solution and working on it.