Placeholder image of a protein
Icon representing a puzzle

1961: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
February 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Czech National Team 11. Czech National Team 5 pts. 8,848
  2. Avatar for Team China 12. Team China 4 pts. 8,704
  3. Avatar for BOINC@Poland 13. BOINC@Poland 2 pts. 8,697
  4. Avatar for Australia 14. Australia 2 pts. 8,654
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,574
  6. Avatar for CHM 232 Lab GVSU 16. CHM 232 Lab GVSU 1 pt. 8,151
  7. Avatar for Minions of TWIS 17. Minions of TWIS 1 pt. 8,142
  8. Avatar for Coastal Biochemistry 18. Coastal Biochemistry 1 pt. 8,136
  9. Avatar for SHELL 19. SHELL 1 pt. 5,900
  10. Avatar for Window Group 20. Window Group 1 pt. 3,899

  1. Avatar for multaq 111. multaq Lv 1 1 pt. 8,258
  2. Avatar for JustinRothganger 112. JustinRothganger Lv 1 1 pt. 8,234
  3. Avatar for luigi0411 113. luigi0411 Lv 1 1 pt. 8,225
  4. Avatar for Christine Jang 114. Christine Jang Lv 1 1 pt. 8,214
  5. Avatar for hajtogato 115. hajtogato Lv 1 1 pt. 8,200
  6. Avatar for InfoManiac742 116. InfoManiac742 Lv 1 1 pt. 8,197
  7. Avatar for piascikk 117. piascikk Lv 1 1 pt. 8,151
  8. Avatar for gldisater 118. gldisater Lv 1 1 pt. 8,142
  9. Avatar for morlando89 119. morlando89 Lv 1 1 pt. 8,136
  10. Avatar for Pibeagles1 120. Pibeagles1 Lv 1 1 pt. 8,108

Comments


APPAAP Lv 1

Does anyone has notice stability problems with this version? I had several breakdowns and needed to restart it many times. I use Windows 7 Home premium 64-bit. Also in the Rama map when I select a residue it is not noticed-marked, although in the protein the residue has a noticed change.

APPAAP Lv 1

I downloaded and installed Foldit 20210222-46aaceaf66-win_x86
but problem persists. When I login and open the puzzle my score says 9415 and Objective bonus +500 but a little bit later windows reports Foldit.exe has stopped working Close program. I didn't save this one pose in the past.

LociOiling Lv 1

The first selected segment isn't highlighted on the Rama map, which is confusing. The devs are aware of the issue and are working on a fix.

In the selection interface, a workaround for seeing a specific segment is to first select any other segment, then select the segment you want. The segment you want will be highlighted with a white box on the Rama map. If you de-select the first segment, your segment loses the highlight. So you have to remember its position if you want to move by itself.

milkshake Lv 1

Hi APPAAP, is there enough time to click the "share with scientists" button? I would like to investigate your crash but I am not experiencing any crashes on puzzle 1961. Thank you.

APPAAP Lv 1

Where is the "share with scientist" button? When logged in I cannot get to the puzzle as soloist.
Can do that from the foldit portal site?
I will try to attach a png image of my laptop screen. Foldit works fine when I am not logged in, as an evolver but when I logged in it tries to get the last saved best score which seems to be problematic. May need to erase some file?

APPAAP Lv 1

I disabled all autosave and last quicksave file solutions from foldit default folder (soloist). Then logged in without a problem as a soloist at initial possition (start). Last loaded a saved evolver solution and working on it.