Placeholder image of a protein
Icon representing a puzzle

1961: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
February 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Marvin's bunch 100 pts. 10,623
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 10,539
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 10,475
  4. Avatar for Go Science 4. Go Science 49 pts. 10,453
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 10,401
  6. Avatar for Gargleblasters 6. Gargleblasters 28 pts. 10,387
  7. Avatar for Contenders 7. Contenders 21 pts. 9,915
  8. Avatar for HMT heritage 8. HMT heritage 15 pts. 9,716
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 9,519
  10. Avatar for Olsztynek 10. Olsztynek 8 pts. 8,923

  1. Avatar for Blipperman 41. Blipperman Lv 1 28 pts. 9,777
  2. Avatar for Vincera 42. Vincera Lv 1 27 pts. 9,749
  3. Avatar for bx7gn 43. bx7gn Lv 1 26 pts. 9,723
  4. Avatar for O Seki To 44. O Seki To Lv 1 25 pts. 9,716
  5. Avatar for infjamc 45. infjamc Lv 1 24 pts. 9,712
  6. Avatar for Deleted player 46. Deleted player pts. 9,600
  7. Avatar for drumpeter18yrs9yrs 47. drumpeter18yrs9yrs Lv 1 22 pts. 9,598
  8. Avatar for donuts554 48. donuts554 Lv 1 21 pts. 9,589
  9. Avatar for heather-1 49. heather-1 Lv 1 21 pts. 9,576
  10. Avatar for vuvuvu 50. vuvuvu Lv 1 20 pts. 9,519

Comments


APPAAP Lv 1

Does anyone has notice stability problems with this version? I had several breakdowns and needed to restart it many times. I use Windows 7 Home premium 64-bit. Also in the Rama map when I select a residue it is not noticed-marked, although in the protein the residue has a noticed change.

APPAAP Lv 1

I downloaded and installed Foldit 20210222-46aaceaf66-win_x86
but problem persists. When I login and open the puzzle my score says 9415 and Objective bonus +500 but a little bit later windows reports Foldit.exe has stopped working Close program. I didn't save this one pose in the past.

LociOiling Lv 1

The first selected segment isn't highlighted on the Rama map, which is confusing. The devs are aware of the issue and are working on a fix.

In the selection interface, a workaround for seeing a specific segment is to first select any other segment, then select the segment you want. The segment you want will be highlighted with a white box on the Rama map. If you de-select the first segment, your segment loses the highlight. So you have to remember its position if you want to move by itself.

milkshake Lv 1

Hi APPAAP, is there enough time to click the "share with scientists" button? I would like to investigate your crash but I am not experiencing any crashes on puzzle 1961. Thank you.

APPAAP Lv 1

Where is the "share with scientist" button? When logged in I cannot get to the puzzle as soloist.
Can do that from the foldit portal site?
I will try to attach a png image of my laptop screen. Foldit works fine when I am not logged in, as an evolver but when I logged in it tries to get the last saved best score which seems to be problematic. May need to erase some file?

APPAAP Lv 1

I disabled all autosave and last quicksave file solutions from foldit default folder (soloist). Then logged in without a problem as a soloist at initial possition (start). Last loaded a saved evolver solution and working on it.