Placeholder image of a protein
Icon representing a puzzle

1972: CMG2 with Density

Closed since about 5 years ago

Advanced Advanced Advanced Advanced Advanced Advanced Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
March 26, 2021
Expires
Max points
100
Description

Fold this CMG2 protein into the electron density map! This protein is a domain of the human capillary morphogenesis protein 2 (CMG2). The CMG2 protein normally associates with other proteins in connective tissue, and is thought to be important for the formation of new blood vessels. But CMG2 is also targeted by the anthrax toxin, and has been implicated in certain types of cancer. The protein in this puzzle is a variant of CMG2 that researchers are studying to better understand its structure and function. This electron density map comes from x-ray crystallography experiments, and outlines the shape of the folded protein. Help us determine the structure of this CMG2 variant by folding it in the electron density!



Sequence:


SARRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYAVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQS

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 11,360
  2. Avatar for Australia 12. Australia 1 pt. 11,277
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,663
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 0

  1. Avatar for spmm 11. spmm Lv 1 64 pts. 13,503
  2. Avatar for Nicm25 12. Nicm25 Lv 1 61 pts. 13,491
  3. Avatar for drumpeter18yrs9yrs 13. drumpeter18yrs9yrs Lv 1 58 pts. 13,414
  4. Avatar for nicobul 14. nicobul Lv 1 55 pts. 13,411
  5. Avatar for Galaxie 15. Galaxie Lv 1 52 pts. 13,335
  6. Avatar for johnmitch 16. johnmitch Lv 1 50 pts. 13,334
  7. Avatar for akaaka 17. akaaka Lv 1 47 pts. 13,233
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 45 pts. 13,147
  9. Avatar for BootsMcGraw 19. BootsMcGraw Lv 1 43 pts. 13,104
  10. Avatar for OWM3 20. OWM3 Lv 1 41 pts. 13,092

Comments