Placeholder image of a protein
Icon representing a puzzle

1972: CMG2 with Density

Closed since almost 5 years ago

Advanced Overall Prediction Electron Density

Summary

Created
March 26, 2021
Expires
Max points
100
Description

Fold this CMG2 protein into the electron density map! This protein is a domain of the human capillary morphogenesis protein 2 (CMG2). The CMG2 protein normally associates with other proteins in connective tissue, and is thought to be important for the formation of new blood vessels. But CMG2 is also targeted by the anthrax toxin, and has been implicated in certain types of cancer. The protein in this puzzle is a variant of CMG2 that researchers are studying to better understand its structure and function. This electron density map comes from x-ray crystallography experiments, and outlines the shape of the folded protein. Help us determine the structure of this CMG2 variant by folding it in the electron density!



Sequence:


SARRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYAVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQS

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 11,360
  2. Avatar for Australia 12. Australia 1 pt. 11,277
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,663
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 0
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 0
  1. Avatar for guineapig 21. guineapig Lv 1 39 pts. 13,022
  2. Avatar for NinjaGreg 22. NinjaGreg Lv 1 37 pts. 13,009
  3. Avatar for donuts554 23. donuts554 Lv 1 35 pts. 13,009
  4. Avatar for Pazithi 24. Pazithi Lv 1 33 pts. 12,967
  5. Avatar for Scopper 25. Scopper Lv 1 31 pts. 12,846
  6. Avatar for jobo0502 26. jobo0502 Lv 1 30 pts. 12,842
  7. Avatar for aznarog 27. aznarog Lv 1 28 pts. 12,689
  8. Avatar for blazegeek 28. blazegeek Lv 1 26 pts. 12,666
  9. Avatar for silent gene 29. silent gene Lv 1 25 pts. 12,625
  10. Avatar for maithra 30. maithra Lv 1 24 pts. 12,619

Comments