Placeholder image of a protein
Icon representing a puzzle

1972: CMG2 with Density

Closed since about 5 years ago

Advanced Advanced Advanced Advanced Advanced Advanced Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
March 26, 2021
Expires
Max points
100
Description

Fold this CMG2 protein into the electron density map! This protein is a domain of the human capillary morphogenesis protein 2 (CMG2). The CMG2 protein normally associates with other proteins in connective tissue, and is thought to be important for the formation of new blood vessels. But CMG2 is also targeted by the anthrax toxin, and has been implicated in certain types of cancer. The protein in this puzzle is a variant of CMG2 that researchers are studying to better understand its structure and function. This electron density map comes from x-ray crystallography experiments, and outlines the shape of the folded protein. Help us determine the structure of this CMG2 variant by folding it in the electron density!



Sequence:


SARRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYAVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQS

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 11,360
  2. Avatar for Australia 12. Australia 1 pt. 11,277
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,663
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 0

  1. Avatar for Bletchley Park 31. Bletchley Park Lv 1 22 pts. 12,506
  2. Avatar for robgee 32. robgee Lv 1 21 pts. 12,498
  3. Avatar for martinzblavy 33. martinzblavy Lv 1 20 pts. 12,422
  4. Avatar for APPAAP 34. APPAAP Lv 1 19 pts. 12,418
  5. Avatar for manu8170 35. manu8170 Lv 1 18 pts. 12,313
  6. Avatar for REDing 36. REDing Lv 1 16 pts. 12,300
  7. Avatar for MicElephant 37. MicElephant Lv 1 15 pts. 12,281
  8. Avatar for fpc 38. fpc Lv 1 15 pts. 12,279
  9. Avatar for NeLikomSheet 39. NeLikomSheet Lv 1 14 pts. 12,242
  10. Avatar for Todd6485577 40. Todd6485577 Lv 1 13 pts. 12,154

Comments