Placeholder image of a protein
Icon representing a puzzle

1972: CMG2 with Density

Closed since about 5 years ago

Advanced Overall Prediction Electron Density

Summary

Created
March 26, 2021
Expires
Max points
100
Description

Fold this CMG2 protein into the electron density map! This protein is a domain of the human capillary morphogenesis protein 2 (CMG2). The CMG2 protein normally associates with other proteins in connective tissue, and is thought to be important for the formation of new blood vessels. But CMG2 is also targeted by the anthrax toxin, and has been implicated in certain types of cancer. The protein in this puzzle is a variant of CMG2 that researchers are studying to better understand its structure and function. This electron density map comes from x-ray crystallography experiments, and outlines the shape of the folded protein. Help us determine the structure of this CMG2 variant by folding it in the electron density!



Sequence:


SARRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYAVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQS

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 11,360
  2. Avatar for Australia 12. Australia 1 pt. 11,277
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,663
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 0
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 0
  1. Avatar for Trajan464 51. Trajan464 Lv 1 6 pts. 11,596
  2. Avatar for Pawel Tluscik 52. Pawel Tluscik Lv 1 6 pts. 11,561
  3. Avatar for Lotus23 53. Lotus23 Lv 1 5 pts. 11,546
  4. Avatar for ziyu zhou 54. ziyu zhou Lv 1 5 pts. 11,535
  5. Avatar for tracybutt 55. tracybutt Lv 1 5 pts. 11,392
  6. Avatar for vuvuvu 56. vuvuvu Lv 1 4 pts. 11,360
  7. Avatar for sciencewalker 57. sciencewalker Lv 1 4 pts. 11,324
  8. Avatar for georg137 58. georg137 Lv 1 4 pts. 11,302
  9. Avatar for AlkiP0Ps 59. AlkiP0Ps Lv 1 3 pts. 11,277
  10. Avatar for pascal ochem 60. pascal ochem Lv 1 3 pts. 11,273

Comments