Placeholder image of a protein
Icon representing a puzzle

1972: CMG2 with Density

Closed since almost 5 years ago

Advanced Overall Prediction Electron Density

Summary


Created
March 26, 2021
Expires
Max points
100
Description

Fold this CMG2 protein into the electron density map! This protein is a domain of the human capillary morphogenesis protein 2 (CMG2). The CMG2 protein normally associates with other proteins in connective tissue, and is thought to be important for the formation of new blood vessels. But CMG2 is also targeted by the anthrax toxin, and has been implicated in certain types of cancer. The protein in this puzzle is a variant of CMG2 that researchers are studying to better understand its structure and function. This electron density map comes from x-ray crystallography experiments, and outlines the shape of the folded protein. Help us determine the structure of this CMG2 variant by folding it in the electron density!



Sequence:


SARRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYAVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQS

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 11,360
  2. Avatar for Australia 12. Australia 1 pt. 11,277
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,663
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 0

  1. Avatar for RWoodcock 61. RWoodcock Lv 1 3 pts. 11,226
  2. Avatar for Oransche 62. Oransche Lv 1 3 pts. 11,187
  3. Avatar for Wiz kid 63. Wiz kid Lv 1 2 pts. 11,164
  4. Avatar for Beany 64. Beany Lv 1 2 pts. 11,141
  5. Avatar for Evica 65. Evica Lv 1 2 pts. 11,107
  6. Avatar for zeluis 66. zeluis Lv 1 2 pts. 11,068
  7. Avatar for Dr.Sillem 67. Dr.Sillem Lv 1 2 pts. 11,037
  8. Avatar for Hellcat6 68. Hellcat6 Lv 1 2 pts. 11,007
  9. Avatar for Jpilkington 69. Jpilkington Lv 1 2 pts. 10,930
  10. Avatar for rinze 70. rinze Lv 1 1 pt. 10,922

Comments