Placeholder image of a protein
Icon representing a puzzle

1972: CMG2 with Density

Closed since about 5 years ago

Advanced Advanced Advanced Advanced Advanced Advanced Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
March 26, 2021
Expires
Max points
100
Description

Fold this CMG2 protein into the electron density map! This protein is a domain of the human capillary morphogenesis protein 2 (CMG2). The CMG2 protein normally associates with other proteins in connective tissue, and is thought to be important for the formation of new blood vessels. But CMG2 is also targeted by the anthrax toxin, and has been implicated in certain types of cancer. The protein in this puzzle is a variant of CMG2 that researchers are studying to better understand its structure and function. This electron density map comes from x-ray crystallography experiments, and outlines the shape of the folded protein. Help us determine the structure of this CMG2 variant by folding it in the electron density!



Sequence:


SARRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYAVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQS

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 11,360
  2. Avatar for Australia 12. Australia 1 pt. 11,277
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,663
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 0

  1. Avatar for PeterDav 81. PeterDav Lv 1 1 pt. 10,427
  2. Avatar for Altercomp 82. Altercomp Lv 1 1 pt. 10,415
  3. Avatar for Mohoernchen 83. Mohoernchen Lv 1 1 pt. 10,350
  4. Avatar for HuubR 84. HuubR Lv 1 1 pt. 10,150
  5. Avatar for DScott 85. DScott Lv 1 1 pt. 10,034
  6. Avatar for D4ng 86. D4ng Lv 1 1 pt. 10,015
  7. Avatar for jawz101 87. jawz101 Lv 1 1 pt. 9,895
  8. Avatar for grogar7 88. grogar7 Lv 1 1 pt. 9,761
  9. Avatar for abiogenesis 89. abiogenesis Lv 1 1 pt. 9,697
  10. Avatar for harvardman 90. harvardman Lv 1 1 pt. 9,628

Comments