Placeholder image of a protein
Icon representing a puzzle

1972: CMG2 with Density

Closed since about 5 years ago

Advanced Overall Prediction Electron Density

Summary


Created
March 26, 2021
Expires
Max points
100
Description

Fold this CMG2 protein into the electron density map! This protein is a domain of the human capillary morphogenesis protein 2 (CMG2). The CMG2 protein normally associates with other proteins in connective tissue, and is thought to be important for the formation of new blood vessels. But CMG2 is also targeted by the anthrax toxin, and has been implicated in certain types of cancer. The protein in this puzzle is a variant of CMG2 that researchers are studying to better understand its structure and function. This electron density map comes from x-ray crystallography experiments, and outlines the shape of the folded protein. Help us determine the structure of this CMG2 variant by folding it in the electron density!



Sequence:


SARRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYAVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQS

Top groups


  1. Avatar for Go Science 100 pts. 17,522
  2. Avatar for Marvin's bunch 2. Marvin's bunch 70 pts. 14,860
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 14,127
  4. Avatar for Contenders 4. Contenders 30 pts. 14,094
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 13,773
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 13,503
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 7 pts. 13,335
  8. Avatar for Gargleblasters 8. Gargleblasters 4 pts. 13,118
  9. Avatar for Team China 9. Team China 2 pts. 12,300
  10. Avatar for Olsztynek 10. Olsztynek 1 pt. 11,561

  1. Avatar for AJH1472 91. AJH1472 Lv 1 1 pt. 9,560
  2. Avatar for cjddig 92. cjddig Lv 1 1 pt. 9,362
  3. Avatar for fishercat 93. fishercat Lv 1 1 pt. 9,197
  4. Avatar for ivalnic 94. ivalnic Lv 1 1 pt. 9,186
  5. Avatar for ProfVince 95. ProfVince Lv 1 1 pt. 8,837
  6. Avatar for ihook 96. ihook Lv 1 1 pt. 8,749
  7. Avatar for GOAT_STJ 97. GOAT_STJ Lv 1 1 pt. 8,711
  8. Avatar for Sammy3c2b1a0 98. Sammy3c2b1a0 Lv 1 1 pt. 8,683
  9. Avatar for kotenok2000 99. kotenok2000 Lv 1 1 pt. 8,671
  10. Avatar for hada 100. hada Lv 1 1 pt. 8,578

Comments