Placeholder image of a protein
Icon representing a puzzle

1975: Revisiting Puzzle 60: Beta Barrel

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Olsztynek 11. Olsztynek 2 pts. 11,501
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,196
  3. Avatar for Australia 13. Australia 1 pt. 10,981
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 10,674
  5. Avatar for Czech National Team 15. Czech National Team 1 pt. 10,550
  6. Avatar for Russian team 16. Russian team 1 pt. 10,414
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 7,850
  8. Avatar for Window Group 18. Window Group 1 pt. 6,494
  9. Avatar for bmd 19. bmd 1 pt. 4,514
  1. Avatar for Deleted player
    1. Deleted player
    100 pts. 12,808
  2. Avatar for LociOiling 2. LociOiling Lv 1 78 pts. 12,799
  3. Avatar for jausmh 3. jausmh Lv 1 60 pts. 12,616
  4. Avatar for fpc 4. fpc Lv 1 45 pts. 12,612
  5. Avatar for mirp 5. mirp Lv 1 33 pts. 12,452
  6. Avatar for TurtleByte 6. TurtleByte Lv 1 24 pts. 12,451
  7. Avatar for Galaxie 7. Galaxie Lv 1 17 pts. 12,450
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 12 pts. 12,449
  9. Avatar for toshiue 9. toshiue Lv 1 8 pts. 12,448
  10. Avatar for silent gene 10. silent gene Lv 1 6 pts. 12,447

Comments