Placeholder image of a protein
Icon representing a puzzle

1975: Revisiting Puzzle 60: Beta Barrel

Closed since about 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
April 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Olsztynek 11. Olsztynek 2 pts. 11,501
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,196
  3. Avatar for Australia 13. Australia 1 pt. 10,981
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 10,674
  5. Avatar for Czech National Team 15. Czech National Team 1 pt. 10,550
  6. Avatar for Russian team 16. Russian team 1 pt. 10,414
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 7,850
  8. Avatar for Window Group 18. Window Group 1 pt. 6,494
  9. Avatar for bmd 19. bmd 1 pt. 4,514
  1. Avatar for jflat06 131. jflat06 Lv 1 1 pt. 6,494
  2. Avatar for jrehfeldt 132. jrehfeldt Lv 1 1 pt. 5,749
  3. Avatar for bmd_2021_CRHU 133. bmd_2021_CRHU Lv 1 1 pt. 5,421
  4. Avatar for Laddu 134. Laddu Lv 1 1 pt. 4,591
  5. Avatar for ManVsYard 135. ManVsYard Lv 1 1 pt. 4,514
  6. Avatar for bmd_21_AMGE 136. bmd_21_AMGE Lv 1 1 pt. 4,514
  7. Avatar for bmd_21_AZR 137. bmd_21_AZR Lv 1 1 pt. 4,514
  8. Avatar for xyc 138. xyc Lv 1 1 pt. 4,514
  9. Avatar for toshiue 139. toshiue Lv 1 1 pt. 4,514
  10. Avatar for caohyang 140. caohyang Lv 1 1 pt. 4,514

Comments