Placeholder image of a protein
Icon representing a puzzle

1975: Revisiting Puzzle 60: Beta Barrel

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Olsztynek 11. Olsztynek 2 pts. 11,501
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,196
  3. Avatar for Australia 13. Australia 1 pt. 10,981
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 10,674
  5. Avatar for Czech National Team 15. Czech National Team 1 pt. 10,550
  6. Avatar for Russian team 16. Russian team 1 pt. 10,414
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 7,850
  8. Avatar for Window Group 18. Window Group 1 pt. 6,494
  9. Avatar for bmd 19. bmd 1 pt. 4,514
  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 70 pts. 12,347
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 68 pts. 12,325
  3. Avatar for Anfinsen_slept_here 13. Anfinsen_slept_here Lv 1 65 pts. 12,314
  4. Avatar for grogar7 14. grogar7 Lv 1 63 pts. 12,257
  5. Avatar for Bletchley Park 15. Bletchley Park Lv 1 60 pts. 12,230
  6. Avatar for NinjaGreg 16. NinjaGreg Lv 1 58 pts. 12,197
  7. Avatar for g_b 17. g_b Lv 1 56 pts. 12,186
  8. Avatar for fiendish_ghoul 18. fiendish_ghoul Lv 1 54 pts. 12,159
  9. Avatar for nicobul 19. nicobul Lv 1 52 pts. 12,125
  10. Avatar for ProfVince 20. ProfVince Lv 1 50 pts. 12,113

Comments