Placeholder image of a protein
Icon representing a puzzle

1975: Revisiting Puzzle 60: Beta Barrel

Closed since about 5 years ago

Novice Overall Prediction

Summary

Created
April 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Olsztynek 11. Olsztynek 2 pts. 11,501
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,196
  3. Avatar for Australia 13. Australia 1 pt. 10,981
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 10,674
  5. Avatar for Czech National Team 15. Czech National Team 1 pt. 10,550
  6. Avatar for Russian team 16. Russian team 1 pt. 10,414
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 7,850
  8. Avatar for Window Group 18. Window Group 1 pt. 6,494
  9. Avatar for bmd 19. bmd 1 pt. 4,514
  1. Avatar for Blipperman 51. Blipperman Lv 1 12 pts. 11,707
  2. Avatar for Altercomp 52. Altercomp Lv 1 12 pts. 11,673
  3. Avatar for alcor29 53. alcor29 Lv 1 11 pts. 11,671
  4. Avatar for Amphimixus 54. Amphimixus Lv 1 10 pts. 11,668
  5. Avatar for erlorad 55. erlorad Lv 1 10 pts. 11,643
  6. Avatar for phi16 56. phi16 Lv 1 9 pts. 11,634
  7. Avatar for aznarog 57. aznarog Lv 1 9 pts. 11,633
  8. Avatar for martinzblavy 58. martinzblavy Lv 1 8 pts. 11,614
  9. Avatar for kyoota 59. kyoota Lv 1 8 pts. 11,612
  10. Avatar for Trajan464 60. Trajan464 Lv 1 7 pts. 11,591

Comments