1975: Revisiting Puzzle 60: Beta Barrel
Closed since about 5 years ago
Novice Overall PredictionSummary
- Created
- April 01, 2021
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE
Top groups
Comments