Placeholder image of a protein
Icon representing a puzzle

1975: Revisiting Puzzle 60: Beta Barrel

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Olsztynek 11. Olsztynek 2 pts. 11,501
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 11,196
  3. Avatar for Australia 13. Australia 1 pt. 10,981
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 10,674
  5. Avatar for Czech National Team 15. Czech National Team 1 pt. 10,550
  6. Avatar for Russian team 16. Russian team 1 pt. 10,414
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 7,850
  8. Avatar for Window Group 18. Window Group 1 pt. 6,494
  9. Avatar for bmd 19. bmd 1 pt. 4,514
  1. Avatar for roman madala 61. roman madala Lv 1 7 pts. 11,591
  2. Avatar for cjddig 62. cjddig Lv 1 7 pts. 11,563
  3. Avatar for Oransche 63. Oransche Lv 1 6 pts. 11,546
  4. Avatar for tracybutt 64. tracybutt Lv 1 6 pts. 11,543
  5. Avatar for ziyu zhou 65. ziyu zhou Lv 1 6 pts. 11,539
  6. Avatar for pascal ochem 66. pascal ochem Lv 1 5 pts. 11,508
  7. Avatar for Wiz kid 67. Wiz kid Lv 1 5 pts. 11,503
  8. Avatar for Pawel Tluscik 68. Pawel Tluscik Lv 1 5 pts. 11,501
  9. Avatar for fpc 69. fpc Lv 1 4 pts. 11,468
  10. Avatar for abiogenesis 70. abiogenesis Lv 1 4 pts. 11,445

Comments