Placeholder image of a protein
Icon representing a puzzle

1975: Revisiting Puzzle 60: Beta Barrel

Closed since about 5 years ago

Novice Overall Prediction

Summary


Created
April 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Beta Folders 100 pts. 12,819
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 12,616
  3. Avatar for Go Science 3. Go Science 56 pts. 12,455
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 12,450
  5. Avatar for Contenders 5. Contenders 29 pts. 12,422
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 12,400
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 12,090
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 11,962
  9. Avatar for Team China 9. Team China 6 pts. 11,785
  10. Avatar for Void Crushers 10. Void Crushers 4 pts. 11,774

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,819
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 97 pts. 12,455
  3. Avatar for Galaxie 3. Galaxie Lv 1 94 pts. 12,445
  4. Avatar for jobo0502 4. jobo0502 Lv 1 90 pts. 12,400
  5. Avatar for mirp 5. mirp Lv 1 87 pts. 12,392
  6. Avatar for robgee 6. robgee Lv 1 84 pts. 12,382
  7. Avatar for WBarme1234 7. WBarme1234 Lv 1 81 pts. 12,376
  8. Avatar for silent gene 8. silent gene Lv 1 78 pts. 12,369
  9. Avatar for Deleted player 9. Deleted player 75 pts. 12,356
  10. Avatar for frood66 10. frood66 Lv 1 73 pts. 12,355

Comments