Placeholder image of a protein
Icon representing a puzzle

1975: Revisiting Puzzle 60: Beta Barrel

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 12,819
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 12,616
  3. Avatar for Go Science 3. Go Science 56 pts. 12,455
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 12,450
  5. Avatar for Contenders 5. Contenders 29 pts. 12,422
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 12,400
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 12,090
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 11,962
  9. Avatar for Team China 9. Team China 6 pts. 11,785
  10. Avatar for Void Crushers 10. Void Crushers 4 pts. 11,774
  1. Avatar for AmaralMo 91. AmaralMo Lv 1 1 pt. 11,122
  2. Avatar for hajtogato 92. hajtogato Lv 1 1 pt. 11,108
  3. Avatar for Zhang Yifang 93. Zhang Yifang Lv 1 1 pt. 11,103
  4. Avatar for proteanOrigami 94. proteanOrigami Lv 1 1 pt. 11,102
  5. Avatar for Lil_Void 95. Lil_Void Lv 1 1 pt. 11,100
  6. Avatar for xbp 96. xbp Lv 1 1 pt. 11,080
  7. Avatar for ERVs 97. ERVs Lv 1 1 pt. 11,059
  8. Avatar for 01010000 01001010 98. 01010000 01001010 Lv 1 1 pt. 11,041
  9. Avatar for Dr.Sillem 99. Dr.Sillem Lv 1 1 pt. 11,034
  10. Avatar for Mohoernchen 100. Mohoernchen Lv 1 1 pt. 11,022

Comments