Placeholder image of a protein
Icon representing a puzzle

1975: Revisiting Puzzle 60: Beta Barrel

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 01, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 12,819
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 12,616
  3. Avatar for Go Science 3. Go Science 56 pts. 12,455
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 12,450
  5. Avatar for Contenders 5. Contenders 29 pts. 12,422
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 12,400
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 12,090
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 11,962
  9. Avatar for Team China 9. Team China 6 pts. 11,785
  10. Avatar for Void Crushers 10. Void Crushers 4 pts. 11,774
  1. Avatar for pauldunn 31. pauldunn Lv 1 31 pts. 12,002
  2. Avatar for TurtleByte 32. TurtleByte Lv 1 30 pts. 11,988
  3. Avatar for maithra 33. maithra Lv 1 29 pts. 11,979
  4. Avatar for ucad 34. ucad Lv 1 27 pts. 11,978
  5. Avatar for borattt 35. borattt Lv 1 26 pts. 11,974
  6. Avatar for vuvuvu 36. vuvuvu Lv 1 25 pts. 11,962
  7. Avatar for jausmh 37. jausmh Lv 1 24 pts. 11,953
  8. Avatar for Skippysk8s 38. Skippysk8s Lv 1 23 pts. 11,930
  9. Avatar for blazegeek 39. blazegeek Lv 1 22 pts. 11,911
  10. Avatar for manu8170 40. manu8170 Lv 1 21 pts. 11,898

Comments