Placeholder image of a protein
Icon representing a puzzle

1978: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
April 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Czech National Team 11. Czech National Team 3 pts. 10,832
  2. Avatar for Team China 12. Team China 2 pts. 10,682
  3. Avatar for Russian team 13. Russian team 1 pt. 10,615
  4. Avatar for Australia 14. Australia 1 pt. 10,588
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 10,458
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,172
  7. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,875
  8. Avatar for Trinity Biology 20. Trinity Biology 1 pt. 8,611

  1. Avatar for mirp
    1. mirp Lv 1
    100 pts. 11,700
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 11,685
  3. Avatar for nicobul 3. nicobul Lv 1 94 pts. 11,655
  4. Avatar for TurtleByte 4. TurtleByte Lv 1 91 pts. 11,623
  5. Avatar for robgee 5. robgee Lv 1 88 pts. 11,610
  6. Avatar for grogar7 6. grogar7 Lv 1 85 pts. 11,606
  7. Avatar for drumpeter18yrs9yrs 7. drumpeter18yrs9yrs Lv 1 82 pts. 11,600
  8. Avatar for g_b 8. g_b Lv 1 80 pts. 11,588
  9. Avatar for BootsMcGraw 9. BootsMcGraw Lv 1 77 pts. 11,587
  10. Avatar for Skippysk8s 10. Skippysk8s Lv 1 75 pts. 11,551

Comments