Placeholder image of a protein
Icon representing a puzzle

1978: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 3 pts. 10,832
  2. Avatar for Team China 12. Team China 2 pts. 10,682
  3. Avatar for Russian team 13. Russian team 1 pt. 10,615
  4. Avatar for Australia 14. Australia 1 pt. 10,588
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 10,458
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,172
  7. Avatar for Richard Dawkins Foundation 17. Richard Dawkins Foundation 1 pt. 10,042
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 9,875
  9. Avatar for CHEM 102 Protein Folding Lab 19. CHEM 102 Protein Folding Lab 1 pt. 9,854
  10. Avatar for Trinity Biology 20. Trinity Biology 1 pt. 8,611
  1. Avatar for georg137
    1. georg137 Lv 1
    100 pts. 11,717
  2. Avatar for BootsMcGraw 2. BootsMcGraw Lv 1 77 pts. 11,712
  3. Avatar for toshiue 3. toshiue Lv 1 58 pts. 11,695
  4. Avatar for mirp 4. mirp Lv 1 43 pts. 11,693
  5. Avatar for Galaxie 5. Galaxie Lv 1 31 pts. 11,691
  6. Avatar for LociOiling 6. LociOiling Lv 1 22 pts. 11,682
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 15 pts. 11,678
  8. Avatar for kyoota 8. kyoota Lv 1 11 pts. 11,673
  9. Avatar for argyrw 9. argyrw Lv 1 7 pts. 11,670
  10. Avatar for robgee 10. robgee Lv 1 5 pts. 11,647

Comments