1978: Revisiting Puzzle 61: Designer Protein Top7
Closed since almost 5 years ago
Novice Novice Overall Overall Prediction PredictionSummary
- Created
- April 08, 2021
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL