Placeholder image of a protein
Icon representing a puzzle

1978: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Contenders 100 pts. 11,717
  2. Avatar for Go Science 2. Go Science 77 pts. 11,700
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,691
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 11,685
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 11,655
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 11,562
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 11,551
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 11 pts. 11,019
  9. Avatar for Olsztynek 9. Olsztynek 7 pts. 11,011
  10. Avatar for BOINC@Poland 10. BOINC@Poland 5 pts. 10,903

  1. Avatar for Deleted player 101. Deleted player pts. 10,325
  2. Avatar for dahast.de 102. dahast.de Lv 1 1 pt. 10,300
  3. Avatar for argyrw 103. argyrw Lv 1 1 pt. 10,273
  4. Avatar for Mohoernchen 104. Mohoernchen Lv 1 1 pt. 10,206
  5. Avatar for hajtogato 105. hajtogato Lv 1 1 pt. 10,185
  6. Avatar for Todd6485577 106. Todd6485577 Lv 1 1 pt. 10,179
  7. Avatar for Savas 107. Savas Lv 1 1 pt. 10,172
  8. Avatar for rinze 108. rinze Lv 1 1 pt. 10,158
  9. Avatar for pascal ochem 109. pascal ochem Lv 1 1 pt. 10,144
  10. Avatar for proteanOrigami 110. proteanOrigami Lv 1 1 pt. 10,139

Comments