Placeholder image of a protein
Icon representing a puzzle

1978: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Contenders 100 pts. 11,717
  2. Avatar for Go Science 2. Go Science 77 pts. 11,700
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,691
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 11,685
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 11,655
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 11,562
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 11,551
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 11 pts. 11,019
  9. Avatar for Olsztynek 9. Olsztynek 7 pts. 11,011
  10. Avatar for BOINC@Poland 10. BOINC@Poland 5 pts. 10,903

  1. Avatar for AeonFluff 51. AeonFluff Lv 1 15 pts. 11,063
  2. Avatar for Trajan464 52. Trajan464 Lv 1 14 pts. 11,049
  3. Avatar for vuvuvu 53. vuvuvu Lv 1 13 pts. 11,019
  4. Avatar for Pawel Tluscik 54. Pawel Tluscik Lv 1 13 pts. 11,011
  5. Avatar for martinzblavy 55. martinzblavy Lv 1 12 pts. 10,989
  6. Avatar for Deleted player 56. Deleted player 11 pts. 10,979
  7. Avatar for Blipperman 57. Blipperman Lv 1 11 pts. 10,962
  8. Avatar for bx7gn 58. bx7gn Lv 1 10 pts. 10,946
  9. Avatar for WBarme1234 59. WBarme1234 Lv 1 10 pts. 10,933
  10. Avatar for Vincera 60. Vincera Lv 1 9 pts. 10,925

Comments