Placeholder image of a protein
Icon representing a puzzle

1978: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
April 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Contenders 100 pts. 11,717
  2. Avatar for Go Science 2. Go Science 77 pts. 11,700
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,691
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 11,685
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 11,655
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 11,562
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 11,551
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 11 pts. 11,019
  9. Avatar for Olsztynek 9. Olsztynek 7 pts. 11,011
  10. Avatar for BOINC@Poland 10. BOINC@Poland 5 pts. 10,903

  1. Avatar for ShadowTactics 61. ShadowTactics Lv 1 9 pts. 10,903
  2. Avatar for ManVsYard 62. ManVsYard Lv 1 9 pts. 10,863
  3. Avatar for Alistair69 63. Alistair69 Lv 1 8 pts. 10,863
  4. Avatar for fishercat 64. fishercat Lv 1 8 pts. 10,847
  5. Avatar for heather-1 65. heather-1 Lv 1 7 pts. 10,845
  6. Avatar for borattt 66. borattt Lv 1 7 pts. 10,843
  7. Avatar for Dr.Sillem 67. Dr.Sillem Lv 1 7 pts. 10,833
  8. Avatar for vybi 68. vybi Lv 1 6 pts. 10,832
  9. Avatar for Oransche 69. Oransche Lv 1 6 pts. 10,825
  10. Avatar for rezaefar 70. rezaefar Lv 1 6 pts. 10,788

Comments