Placeholder image of a protein
Icon representing a puzzle

1978: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 11,717
  2. Avatar for Go Science 2. Go Science 77 pts. 11,700
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,691
  4. Avatar for Beta Folders 4. Beta Folders 43 pts. 11,685
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 11,655
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 11,562
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 11,551
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 11 pts. 11,019
  9. Avatar for Olsztynek 9. Olsztynek 7 pts. 11,011
  10. Avatar for BOINC@Poland 10. BOINC@Poland 5 pts. 10,903
  1. Avatar for silent gene 11. silent gene Lv 1 72 pts. 11,547
  2. Avatar for Phyx 12. Phyx Lv 1 70 pts. 11,546
  3. Avatar for guineapig 13. guineapig Lv 1 67 pts. 11,545
  4. Avatar for PigeonBar 14. PigeonBar Lv 1 65 pts. 11,528
  5. Avatar for georg137 15. georg137 Lv 1 63 pts. 11,522
  6. Avatar for fiendish_ghoul 16. fiendish_ghoul Lv 1 60 pts. 11,507
  7. Avatar for Bruno Kestemont 17. Bruno Kestemont Lv 1 58 pts. 11,503
  8. Avatar for equilibria 18. equilibria Lv 1 56 pts. 11,498
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 54 pts. 11,490
  10. Avatar for MicElephant 20. MicElephant Lv 1 52 pts. 11,487

Comments