Placeholder image of a protein
Icon representing a puzzle

1987: Revisiting Puzzle 63: Spinach Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
April 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,225
  2. Avatar for Manthan - DRILS 12. Manthan - DRILS 1 pt. 10,115
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 10,111
  4. Avatar for 104-Biology (2020) 15. 104-Biology (2020) 1 pt. 6,734
  5. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,437
  6. Avatar for CHE222_2021 1 17. CHE222_2021 1 1 pt. 4,359

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,214
  2. Avatar for Deleted player 2. Deleted player 80 pts. 11,203
  3. Avatar for Galaxie 3. Galaxie Lv 1 63 pts. 11,123
  4. Avatar for jausmh 4. jausmh Lv 1 49 pts. 11,113
  5. Avatar for fpc 5. fpc Lv 1 37 pts. 11,110
  6. Avatar for Lotus23 6. Lotus23 Lv 1 28 pts. 11,093
  7. Avatar for georg137 7. georg137 Lv 1 21 pts. 11,080
  8. Avatar for toshiue 8. toshiue Lv 1 15 pts. 11,038
  9. Avatar for robgee 9. robgee Lv 1 11 pts. 11,031
  10. Avatar for phi16 10. phi16 Lv 1 8 pts. 11,031

Comments