Placeholder image of a protein
Icon representing a puzzle

1987: Revisiting Puzzle 63: Spinach Protein

Closed since about 5 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,225
  2. Avatar for Manthan - DRILS 12. Manthan - DRILS 1 pt. 10,115
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 10,111
  4. Avatar for 104-Biology (2020) 15. 104-Biology (2020) 1 pt. 6,734
  5. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,437
  6. Avatar for CHE222_2021 1 17. CHE222_2021 1 1 pt. 4,359

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,219
  2. Avatar for grogar7 2. grogar7 Lv 1 98 pts. 11,141
  3. Avatar for johnmitch 3. johnmitch Lv 1 95 pts. 11,115
  4. Avatar for frood66 4. frood66 Lv 1 92 pts. 11,113
  5. Avatar for fiendish_ghoul 5. fiendish_ghoul Lv 1 90 pts. 11,091
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 87 pts. 11,053
  7. Avatar for WBarme1234 7. WBarme1234 Lv 1 84 pts. 11,010
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 82 pts. 11,003
  9. Avatar for bamh 9. bamh Lv 1 80 pts. 10,975
  10. Avatar for akaaka 10. akaaka Lv 1 77 pts. 10,968

Comments