Placeholder image of a protein
Icon representing a puzzle

1987: Revisiting Puzzle 63: Spinach Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
April 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,225
  2. Avatar for Manthan - DRILS 12. Manthan - DRILS 1 pt. 10,115
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 10,111
  4. Avatar for 104-Biology (2020) 15. 104-Biology (2020) 1 pt. 6,734
  5. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,437
  6. Avatar for CHE222_2021 1 17. CHE222_2021 1 1 pt. 4,359

  1. Avatar for MsHsi 91. MsHsi Lv 1 3 pts. 9,491
  2. Avatar for pfirth 92. pfirth Lv 1 3 pts. 9,409
  3. Avatar for sspoerri 94. sspoerri Lv 1 3 pts. 9,320
  4. Avatar for fpc 95. fpc Lv 1 3 pts. 9,271
  5. Avatar for harvardman 96. harvardman Lv 1 2 pts. 9,244
  6. Avatar for Speed_demon157 97. Speed_demon157 Lv 1 2 pts. 9,227
  7. Avatar for oaks 98. oaks Lv 1 2 pts. 9,042
  8. Avatar for pascal ochem 99. pascal ochem Lv 1 2 pts. 8,933
  9. Avatar for AeonFluff 100. AeonFluff Lv 1 2 pts. 8,924

Comments