Placeholder image of a protein
Icon representing a puzzle

1987: Revisiting Puzzle 63: Spinach Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,225
  2. Avatar for Manthan - DRILS 12. Manthan - DRILS 1 pt. 10,115
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 10,111
  4. Avatar for NMHU Cell and Molecular Biology 14. NMHU Cell and Molecular Biology 1 pt. 6,927
  5. Avatar for 104-Biology (2020) 15. 104-Biology (2020) 1 pt. 6,734
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,437
  7. Avatar for CHE222_2021 1 17. CHE222_2021 1 1 pt. 4,359
  1. Avatar for reich64 101. reich64 Lv 1 2 pts. 8,856
  2. Avatar for jausmh 102. jausmh Lv 1 2 pts. 8,713
  3. Avatar for Rav3n_pl 103. Rav3n_pl Lv 1 2 pts. 8,703
  4. Avatar for Evica 104. Evica Lv 1 2 pts. 8,701
  5. Avatar for kyoota 105. kyoota Lv 1 2 pts. 8,646
  6. Avatar for NPrincipi 106. NPrincipi Lv 1 2 pts. 8,510
  7. Avatar for zannipietro 107. zannipietro Lv 1 1 pt. 8,345
  8. Avatar for Oransche 108. Oransche Lv 1 1 pt. 8,300
  9. Avatar for martinf 109. martinf Lv 1 1 pt. 8,199
  10. Avatar for abiogenesis 110. abiogenesis Lv 1 1 pt. 7,334

Comments