Placeholder image of a protein
Icon representing a puzzle

1987: Revisiting Puzzle 63: Spinach Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,225
  2. Avatar for Manthan - DRILS 12. Manthan - DRILS 1 pt. 10,115
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 10,111
  4. Avatar for NMHU Cell and Molecular Biology 14. NMHU Cell and Molecular Biology 1 pt. 6,927
  5. Avatar for 104-Biology (2020) 15. 104-Biology (2020) 1 pt. 6,734
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,437
  7. Avatar for CHE222_2021 1 17. CHE222_2021 1 1 pt. 4,359
  1. Avatar for Matroch 131. Matroch Lv 1 1 pt. 6,443
  2. Avatar for chrisb41 132. chrisb41 Lv 1 1 pt. 6,326
  3. Avatar for furi0us 133. furi0us Lv 1 1 pt. 6,317
  4. Avatar for illex 134. illex Lv 1 1 pt. 6,303
  5. Avatar for HMK 135. HMK Lv 1 1 pt. 6,291
  6. Avatar for bbaier 136. bbaier Lv 1 1 pt. 6,266
  7. Avatar for Aditi Ramanan 137. Aditi Ramanan Lv 1 1 pt. 6,236
  8. Avatar for Zio Stone 138. Zio Stone Lv 1 1 pt. 6,233
  9. Avatar for ivalnic 139. ivalnic Lv 1 1 pt. 6,185
  10. Avatar for 41822075 140. 41822075 Lv 1 1 pt. 6,182

Comments