Placeholder image of a protein
Icon representing a puzzle

1987: Revisiting Puzzle 63: Spinach Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,225
  2. Avatar for Manthan - DRILS 12. Manthan - DRILS 1 pt. 10,115
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 10,111
  4. Avatar for NMHU Cell and Molecular Biology 14. NMHU Cell and Molecular Biology 1 pt. 6,927
  5. Avatar for 104-Biology (2020) 15. 104-Biology (2020) 1 pt. 6,734
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,437
  7. Avatar for CHE222_2021 1 17. CHE222_2021 1 1 pt. 4,359
  1. Avatar for Asyiqin_AN180222 141. Asyiqin_AN180222 Lv 1 1 pt. 6,169
  2. Avatar for 41822089 142. 41822089 Lv 1 1 pt. 6,164
  3. Avatar for Monday Vibe 143. Monday Vibe Lv 1 1 pt. 6,160
  4. Avatar for drodriguez4 144. drodriguez4 Lv 1 1 pt. 6,157
  5. Avatar for SirEds 145. SirEds Lv 1 1 pt. 6,149
  6. Avatar for ketty_97 146. ketty_97 Lv 1 1 pt. 6,089
  7. Avatar for Charliec54 147. Charliec54 Lv 1 1 pt. 6,040
  8. Avatar for cobaltteal 148. cobaltteal Lv 1 1 pt. 5,914
  9. Avatar for 41822099 149. 41822099 Lv 1 1 pt. 5,865
  10. Avatar for 41827019 150. 41827019 Lv 1 1 pt. 5,845

Comments