Placeholder image of a protein
Icon representing a puzzle

1987: Revisiting Puzzle 63: Spinach Protein

Closed since almost 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
April 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,225
  2. Avatar for Manthan - DRILS 12. Manthan - DRILS 1 pt. 10,115
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 10,111
  4. Avatar for NMHU Cell and Molecular Biology 14. NMHU Cell and Molecular Biology 1 pt. 6,927
  5. Avatar for 104-Biology (2020) 15. 104-Biology (2020) 1 pt. 6,734
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,437
  7. Avatar for CHE222_2021 1 17. CHE222_2021 1 1 pt. 4,359
  1. Avatar for gogywastaken 151. gogywastaken Lv 1 1 pt. 5,673
  2. Avatar for devjosh 152. devjosh Lv 1 1 pt. 5,437
  3. Avatar for pcappadocia 153. pcappadocia Lv 1 1 pt. 5,348
  4. Avatar for leegeonhee 154. leegeonhee Lv 1 1 pt. 4,912
  5. Avatar for Walker_Fold 155. Walker_Fold Lv 1 1 pt. 4,887
  6. Avatar for lucasperticaro 156. lucasperticaro Lv 1 1 pt. 4,805
  7. Avatar for AkayOguz21 157. AkayOguz21 Lv 1 1 pt. 4,359
  8. Avatar for pranav_101206 158. pranav_101206 Lv 1 1 pt. 4,338
  9. Avatar for FannyS 159. FannyS Lv 1 1 pt. 3,547
  10. Avatar for Keresto 160. Keresto Lv 1 1 pt. 3,008

Comments