Placeholder image of a protein
Icon representing a puzzle

1987: Revisiting Puzzle 63: Spinach Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
April 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,225
  2. Avatar for Manthan - DRILS 12. Manthan - DRILS 1 pt. 10,115
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 10,111
  4. Avatar for 104-Biology (2020) 15. 104-Biology (2020) 1 pt. 6,734
  5. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,437
  6. Avatar for CHE222_2021 1 17. CHE222_2021 1 1 pt. 4,359

  1. Avatar for Gerongfenh 41. Gerongfenh Lv 1 28 pts. 10,525
  2. Avatar for OWM3 42. OWM3 Lv 1 27 pts. 10,523
  3. Avatar for maithra 43. maithra Lv 1 26 pts. 10,515
  4. Avatar for nicobul 44. nicobul Lv 1 25 pts. 10,510
  5. Avatar for @lison 45. @lison Lv 1 24 pts. 10,509
  6. Avatar for Arne Heessels 46. Arne Heessels Lv 1 23 pts. 10,460
  7. Avatar for jsfoldingaccount 47. jsfoldingaccount Lv 1 22 pts. 10,446
  8. Avatar for zippyc137 48. zippyc137 Lv 1 21 pts. 10,436
  9. Avatar for Vinara 49. Vinara Lv 1 21 pts. 10,433
  10. Avatar for MirsadaH 50. MirsadaH Lv 1 20 pts. 10,429

Comments