Placeholder image of a protein
Icon representing a puzzle

1987: Revisiting Puzzle 63: Spinach Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,225
  2. Avatar for Manthan - DRILS 12. Manthan - DRILS 1 pt. 10,115
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 10,111
  4. Avatar for NMHU Cell and Molecular Biology 14. NMHU Cell and Molecular Biology 1 pt. 6,927
  5. Avatar for 104-Biology (2020) 15. 104-Biology (2020) 1 pt. 6,734
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,437
  7. Avatar for CHE222_2021 1 17. CHE222_2021 1 1 pt. 4,359
  1. Avatar for Altercomp 61. Altercomp Lv 1 13 pts. 10,230
  2. Avatar for manu8170 62. manu8170 Lv 1 12 pts. 10,229
  3. Avatar for ShadowTactics 63. ShadowTactics Lv 1 12 pts. 10,225
  4. Avatar for xythus 64. xythus Lv 1 11 pts. 10,221
  5. Avatar for PieThrower 65. PieThrower Lv 1 11 pts. 10,206
  6. Avatar for Wiz kid 66. Wiz kid Lv 1 10 pts. 10,163
  7. Avatar for fishercat 67. fishercat Lv 1 10 pts. 10,147
  8. Avatar for trishad 68. trishad Lv 1 9 pts. 10,115
  9. Avatar for spdenne 69. spdenne Lv 1 9 pts. 10,111
  10. Avatar for blazegeek 70. blazegeek Lv 1 9 pts. 10,092

Comments