Placeholder image of a protein
Icon representing a puzzle

1987: Revisiting Puzzle 63: Spinach Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
April 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,225
  2. Avatar for Manthan - DRILS 12. Manthan - DRILS 1 pt. 10,115
  3. Avatar for Void Crushers 13. Void Crushers 1 pt. 10,111
  4. Avatar for NMHU Cell and Molecular Biology 14. NMHU Cell and Molecular Biology 1 pt. 6,927
  5. Avatar for 104-Biology (2020) 15. 104-Biology (2020) 1 pt. 6,734
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,437
  7. Avatar for CHE222_2021 1 17. CHE222_2021 1 1 pt. 4,359
  1. Avatar for Karlheinz 71. Karlheinz Lv 1 8 pts. 10,067
  2. Avatar for Trajan464 72. Trajan464 Lv 1 8 pts. 10,066
  3. Avatar for dahast.de 73. dahast.de Lv 1 8 pts. 10,058
  4. Avatar for Vincera 74. Vincera Lv 1 7 pts. 10,056
  5. Avatar for diamonddays 75. diamonddays Lv 1 7 pts. 10,019
  6. Avatar for DScott 76. DScott Lv 1 7 pts. 9,982
  7. Avatar for zackallen 77. zackallen Lv 1 6 pts. 9,952
  8. Avatar for Dr.Sillem 78. Dr.Sillem Lv 1 6 pts. 9,914
  9. Avatar for Blipperman 79. Blipperman Lv 1 6 pts. 9,861
  10. Avatar for Mohoernchen 80. Mohoernchen Lv 1 5 pts. 9,820

Comments