Placeholder image of a protein
Icon representing a puzzle

1987: Revisiting Puzzle 63: Spinach Protein

Closed since about 5 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 29, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Beta Folders 100 pts. 11,219
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 11,141
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 11,113
  4. Avatar for Contenders 4. Contenders 36 pts. 11,080
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 11,053
  6. Avatar for Go Science 6. Go Science 16 pts. 11,038
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 10,928
  8. Avatar for Czech National Team 8. Czech National Team 6 pts. 10,701
  9. Avatar for Team China 9. Team China 4 pts. 10,425
  10. Avatar for Australia 10. Australia 2 pts. 10,278

  1. Avatar for Gerongfenh 41. Gerongfenh Lv 1 28 pts. 10,525
  2. Avatar for OWM3 42. OWM3 Lv 1 27 pts. 10,523
  3. Avatar for maithra 43. maithra Lv 1 26 pts. 10,515
  4. Avatar for nicobul 44. nicobul Lv 1 25 pts. 10,510
  5. Avatar for @lison 45. @lison Lv 1 24 pts. 10,509
  6. Avatar for Arne Heessels 46. Arne Heessels Lv 1 23 pts. 10,460
  7. Avatar for jsfoldingaccount 47. jsfoldingaccount Lv 1 22 pts. 10,446
  8. Avatar for zippyc137 48. zippyc137 Lv 1 21 pts. 10,436
  9. Avatar for Vinara 49. Vinara Lv 1 21 pts. 10,433
  10. Avatar for MirsadaH 50. MirsadaH Lv 1 20 pts. 10,429

Comments