Placeholder image of a protein
Icon representing a puzzle

2001: Revisiting Puzzle 66: Cytochrome

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
June 03, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 10,026
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,995
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,710
  4. Avatar for Australia 14. Australia 1 pt. 9,669
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,810

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,247
  2. Avatar for Deleted player 2. Deleted player 71 pts. 10,246
  3. Avatar for mirp 3. mirp Lv 1 49 pts. 10,244
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 33 pts. 10,243
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 22 pts. 10,238
  6. Avatar for Galaxie 6. Galaxie Lv 1 14 pts. 10,237
  7. Avatar for silent gene 7. silent gene Lv 1 8 pts. 10,235
  8. Avatar for Norrjane 8. Norrjane Lv 1 5 pts. 10,235
  9. Avatar for Maerlyn138 9. Maerlyn138 Lv 1 3 pts. 10,230
  10. Avatar for fpc 10. fpc Lv 1 2 pts. 10,173

Comments