Placeholder image of a protein
Icon representing a puzzle

2001: Revisiting Puzzle 66: Cytochrome

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
June 03, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 10,026
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,995
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,710
  4. Avatar for Australia 14. Australia 1 pt. 9,669
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,810
  1. Avatar for Hellcat6 91. Hellcat6 Lv 1 1 pt. 9,652
  2. Avatar for Altercomp 92. Altercomp Lv 1 1 pt. 9,623
  3. Avatar for pfirth 93. pfirth Lv 1 1 pt. 9,622
  4. Avatar for __str__ 94. __str__ Lv 1 1 pt. 9,620
  5. Avatar for Thai Leong Lai 95. Thai Leong Lai Lv 1 1 pt. 9,619
  6. Avatar for Larini 96. Larini Lv 1 1 pt. 9,613
  7. Avatar for pascal ochem 97. pascal ochem Lv 1 1 pt. 9,604
  8. Avatar for frostschutz 98. frostschutz Lv 1 1 pt. 9,600
  9. Avatar for Juronik 99. Juronik Lv 1 1 pt. 9,552
  10. Avatar for Beany 100. Beany Lv 1 1 pt. 9,547

Comments