Placeholder image of a protein
Icon representing a puzzle

2001: Revisiting Puzzle 66: Cytochrome

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
June 03, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 10,026
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,995
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,710
  4. Avatar for Australia 14. Australia 1 pt. 9,669
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,810
  1. Avatar for furi0us 101. furi0us Lv 1 1 pt. 9,535
  2. Avatar for Squirrely 102. Squirrely Lv 1 1 pt. 9,532
  3. Avatar for harvardman 103. harvardman Lv 1 1 pt. 9,524
  4. Avatar for jeli 104. jeli Lv 1 1 pt. 9,522
  5. Avatar for DScott 105. DScott Lv 1 1 pt. 9,482
  6. Avatar for lwelite 106. lwelite Lv 1 1 pt. 9,482
  7. Avatar for saeb_19 107. saeb_19 Lv 1 1 pt. 9,473
  8. Avatar for 41822097 108. 41822097 Lv 1 1 pt. 9,398
  9. Avatar for jegli 109. jegli Lv 1 1 pt. 9,394
  10. Avatar for HMK 110. HMK Lv 1 1 pt. 9,381

Comments