Placeholder image of a protein
Icon representing a puzzle

2001: Revisiting Puzzle 66: Cytochrome

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
June 03, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 10,026
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,995
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,710
  4. Avatar for Australia 14. Australia 1 pt. 9,669
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,810

  1. Avatar for deathbat_87 111. deathbat_87 Lv 1 1 pt. 9,353
  2. Avatar for bswalsh 112. bswalsh Lv 1 1 pt. 9,317
  3. Avatar for InfoManiac742 113. InfoManiac742 Lv 1 1 pt. 9,280
  4. Avatar for ykcowrebbaJ 114. ykcowrebbaJ Lv 1 1 pt. 9,249
  5. Avatar for incognito genie 115. incognito genie Lv 1 1 pt. 9,248
  6. Avatar for irenagrocka 116. irenagrocka Lv 1 1 pt. 9,242
  7. Avatar for Wout_Rig 117. Wout_Rig Lv 1 1 pt. 9,228
  8. Avatar for DipsyDoodle2016 118. DipsyDoodle2016 Lv 1 1 pt. 9,198
  9. Avatar for Hollinas 119. Hollinas Lv 1 1 pt. 9,168
  10. Avatar for andy0002229 120. andy0002229 Lv 1 1 pt. 9,147

Comments