Placeholder image of a protein
Icon representing a puzzle

2001: Revisiting Puzzle 66: Cytochrome

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
June 03, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 10,026
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,995
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,710
  4. Avatar for Australia 14. Australia 1 pt. 9,669
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,810
  1. Avatar for aquaria 121. aquaria Lv 1 1 pt. 9,142
  2. Avatar for parsnip 122. parsnip Lv 1 1 pt. 9,115
  3. Avatar for tigergirl 123. tigergirl Lv 1 1 pt. 9,109
  4. Avatar for Aurephelia 124. Aurephelia Lv 1 1 pt. 9,107
  5. Avatar for origamiti 125. origamiti Lv 1 1 pt. 9,055
  6. Avatar for RKAredknightalpha 126. RKAredknightalpha Lv 1 1 pt. 9,050
  7. Avatar for DarkAdrianus 127. DarkAdrianus Lv 1 1 pt. 9,033
  8. Avatar for ivalnic 128. ivalnic Lv 1 1 pt. 8,956
  9. Avatar for Hydra666 129. Hydra666 Lv 1 1 pt. 8,940
  10. Avatar for geforq 130. geforq Lv 1 1 pt. 8,367

Comments