Placeholder image of a protein
Icon representing a puzzle

2001: Revisiting Puzzle 66: Cytochrome

Closed since almost 5 years ago

Novice Overall Prediction

Summary


Created
June 03, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 10,026
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,995
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,710
  4. Avatar for Australia 14. Australia 1 pt. 9,669
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,810

  1. Avatar for Checker Kev 131. Checker Kev Lv 1 1 pt. 7,944
  2. Avatar for bkoep 132. bkoep Lv 1 1 pt. 7,810
  3. Avatar for italonobre 133. italonobre Lv 1 1 pt. 7,771
  4. Avatar for Mfmahmood 134. Mfmahmood Lv 1 1 pt. 7,737
  5. Avatar for gyunghee 135. gyunghee Lv 1 1 pt. 7,737
  6. Avatar for hanaee 136. hanaee Lv 1 1 pt. 7,737
  7. Avatar for ILUI 137. ILUI Lv 1 1 pt. 7,737
  8. Avatar for BD_Ev 138. BD_Ev Lv 1 1 pt. 7,737
  9. Avatar for tevdorey 139. tevdorey Lv 1 1 pt. 7,737
  10. Avatar for hanickas 140. hanickas Lv 1 1 pt. 7,737

Comments